PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14752.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 354aa    MW: 39210.7 Da    PI: 8.9337
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14752.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-3941101262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ke+a++cprC+s ntkfCyynnysl+qPryfCk+CrryWt+GG+lrn+PvGgg+rknk+ss
  KHN14752.1  41 KEQAINCPRCHSINTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNIPVGGGSRKNKRSS 101
                 7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-273393IPR003851Zinc finger, Dof-type
PfamPF027012.1E-334399IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6214599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MDTAQWPQEM VVKPIEDIVV TNTTCTKAAV GSVERKPRPQ KEQAINCPRC HSINTKFCYY  60
NNYSLTQPRY FCKTCRRYWT EGGTLRNIPV GGGSRKNKRS SASCSNNSHH NDNNSTNKKL  120
SADLVITPPT LSHTTQNPKS NDNSIIHQGQ DLNLAFPSTT TTTSDFRKIS ELVQQNNNNN  180
SSNNSMSASS STTTTTTSTS HHLSALELLT GITSSSSTGL STSFMPIPVP SNPNSIYTCG  240
FPLQDFKPGT LNFSLDGIGK GYTSLQNVHG GRLLFPFEDL KQVSSTTHNE SDATRGFNWV  300
LDWNVRRRIM IMWGLHLFGF LHNWLTADRI DSYVGFFSTS VNFLCVSGSS YISS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572690.0DQ857269.1 Glycine max Dof19 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589241.10.0PREDICTED: dof zinc finger protein DOF4.6 isoform X4
TrEMBLA0A0B2Q4Q10.0A0A0B2Q4Q1_GLYSO; Dof zinc finger protein DOF4.6
STRINGGLYMA10G31700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-44Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]